PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016502005.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family B3
Protein Properties Length: 462aa    MW: 52250.1 Da    PI: 7.4302
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016502005.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B336.87e-1227116198
                     EEEE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEE CS
              B3   1 ffkvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvk 95 
                     ffk+    + ++ +rl++p +fa+++ ++  ++  + le +sg +Wev++    ++g++ l+ GW++F +   +  g f++F ++ rs f  +v+
  XP_016502005.1  27 FFKII--LSQHECSRLRIPEDFASRYCKNMLNP--VYLEVPSGDVWEVEV--VHSQGQICLGIGWQDFSDFYSISCGHFLMFGYNARSHF--NVT 113
                     66766..66677789***********5454444..***************..999999**************************999999..999 PP

                     EE- CS
              B3  96 vfr 98 
                     +f+
  XP_016502005.1 114 IFD 116
                     987 PP

2B357.62.4e-18239320489
                     E-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSE CS
              B3   4 vltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrse 89 
                      + ps+v++ + l++p kfa+++ +++++  +l+l+ + +  W+vk+  + + +   +t GWk Fv +n+Lk+gD++v++++++++
  XP_016502005.1 239 FMHPSYVTRPHSLSIPLKFARKYFMQNRG--KLVLRVPGSGFWTVKC--TLRTRNAKFTCGWKAFVLDNKLKSGDVCVLEVIKDTK 320
                     5789*******************777555..7***************..555555669**********************988643 PP

3B350.15e-16368457498
                     E-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE- CS
              B3   4 vltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfr 98 
                      + ps+v+  + l++++  a+++   +++   ++l+ ++ rsW +++++  k gr  l +GWk+Fv++n++k+gD++vF+ ++r++f ++v +f 
  XP_016502005.1 368 PMQPSYVSGPS-LTISRVIASKFF--PTRYSNVVLQVPNKRSWALNCTVGTKNGR--LNSGWKKFVQDNNIKVGDVCVFEQVSRTKFLFNVYIFP 457
                     56677777776.999999998885..334458***************77555555..***********************888899988888875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.101.6E-1819118IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.22E-1721118IPR015300DNA-binding pseudobarrel domain
CDDcd100175.77E-1225116No hitNo description
PROSITE profilePS5086310.85625118IPR003340B3 DNA binding domain
PfamPF023621.3E-827116IPR003340B3 DNA binding domain
SMARTSM010192.7E-828118IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.103.4E-24228327IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019369.61E-22229322IPR015300DNA-binding pseudobarrel domain
CDDcd100173.67E-18234330No hitNo description
SMARTSM010193.8E-13235332IPR003340B3 DNA binding domain
PROSITE profilePS5086312.266236330IPR003340B3 DNA binding domain
PfamPF023626.4E-16239321IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.102.2E-23357456IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019363.92E-21358456IPR015300DNA-binding pseudobarrel domain
CDDcd100176.58E-19363457No hitNo description
PROSITE profilePS5086312.167364459IPR003340B3 DNA binding domain
SMARTSM010191.7E-12365459IPR003340B3 DNA binding domain
PfamPF023623.9E-14369457IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 462 aa     Download sequence    Send to blast
MAAKSHLQSG ESSSNWKSST NITQPKFFKI ILSQHECSRL RIPEDFASRY CKNMLNPVYL  60
EVPSGDVWEV EVVHSQGQIC LGIGWQDFSD FYSISCGHFL MFGYNARSHF NVTIFDLSAS  120
EIEYPTKEIE SDDSIDISDV AEHSVENLSH GPLGQERKRK RQEGEAEDDI PVNVQTKVIE  180
EEESQGNVVS LERSEGCREQ EQQSNIFTSK SDAERDEERA ENYQSAKAFK SKNPFIISFM  240
HPSYVTRPHS LSIPLKFARK YFMQNRGKLV LRVPGSGFWT VKCTLRTRNA KFTCGWKAFV  300
LDNKLKSGDV CVLEVIKDTK LLLIDVTIFP GVSDSTNESI NAEASVPCSP AYQRAKAFTS  360
ENPFFIYPMQ PSYVSGPSLT ISRVIASKFF PTRYSNVVLQ VPNKRSWALN CTVGTKNGRL  420
NSGWKKFVQD NNIKVGDVCV FEQVSRTKFL FNVYIFPAVE GV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4i1k_A2e-1521732930140B3 domain-containing transcription factor VRN
4i1k_B2e-1521732930140B3 domain-containing transcription factor VRN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009612274.10.0PREDICTED: B3 domain-containing transcription factor VRN1-like
RefseqXP_016502005.10.0PREDICTED: B3 domain-containing transcription factor VRN1-like
TrEMBLM0ZSN01e-173M0ZSN0_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000071991e-173(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA7591893
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18990.13e-35B3 family protein